Livin is a member of IAP family characterized by the presence of an N-terminal, conserved, single BIR domain and a C-terminal RING-type zinc finger domain.
It plays a vital role in caspase regulation, anti-apoptosis and tumorigenesis.
Livin interacts with diverse pro-apoptotic factors and inhibits apoptosis triggered by various death stimuli in a caspase-dependent and caspase-independent methods.
BIR domain of Livin binds to caspase-9, inhibits its proteolysis and induces a caspase-dependent anti-apoptotic cascade.
Alternatively, Livin has also been found to activate MAP kinase and inhibit apoptosis via TAK1/JNK1 signaling cascade.
Northern Blot analysis detected an elevated expression in developmental tissues and human melanomas, suggesting a potential cancer target.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human BIRC7.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human BIRC7, aa1-298 (NP_647478.1).
