83-6004-62 JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222) 50ug 128680
83-6004-62 JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222) 50ug 128680
This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor.
Chromosomal aberrations involving this gene are associated with endometrial stromal tumors.
Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human JAZF1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human JAZF1, aa1-243 (AAH42441.1).
