83-6004-21　Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) 50ug　128546

特徴

• Interleukin-6 (IL6) is a cytokine that functions in inflammation and the maturation of B cells.
• The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.
• The functioning of this IL6 is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.