83-6003-96　IL4R (Interleukin-4 Receptor Subunit alpha, IL-4 Receptor Subunit alpha, IL-4R Subunit alpha, IL-4R-alpha, IL-4RA, CD124, IL4RA, 582J2.1, Soluble Interleukin-4 Receptor Subunit alpha, Soluble IL-4 Receptor Subunit alpha, Soluble IL-4R-alpha, sIL4Ralpha/prot, IL-4-binding Protein, IL4-BP) 50ug　128470

特徴

• Receptor for both interleukin 4 and interleukin 13.
• Couples to the JAK1/2/3-STAT6 pathway.
• The IL4 response is involved in promoting Th2 differentiation.
• The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.
• In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
• Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
• Applications:Suitable for use in Flow Cytometry and Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.