83-6003-90　IL23A (Interleukin-23 Subunit alpha, IL-23 Subunit alpha, IL-23-A, Interleukin-23 Subunit p19, IL-23p19, SGRF, UNQ2498/PRO5798, MGC79388, P19, SGRF) 50ug　128449

特徴

• This monoclonal antibody recognizes human IL-23, a heterodimeric cytokine composed of the p40 subunit shared with IL-12 and a specific p19 subunit.
• This antibody recognizes heterodimeric IL-23, but does not react with the p40 subunit alone or recombinant IL-12(p70) when used as a capture antibody in ELISA.
• IL-23 is secreted by activated dendritic cells and macrophages and has been shown to enhance IFN-y secretion by memory (CD45RO) T cells in an IL-2 dependent manner.
• IL-23 may also induce unique Th subset (designated ThIL-17) that secretes the cytokines IL-17, IL-6, TNF and low levels of IFN-y.
• IL-23 has been shown to promote immunity to mycobacteria and has been shown to be upregulated in response to some viral infections and in psoriatic lesions.
• IL-23 binds to the IL-23 receptor comprised of a B1 subunit shared with the IL-12 receptor and IL-23-specific subunit.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.