83-6003-87　IL1RN (Interleukin-1 Receptor Antagonist Protein, IL-1ra, IL-1RN, IRAP, IL1 Inhibitor, ICIL-1RA, Anakinra, IL1RA, IL1F3, MGC10430) 50ug　128439

特徴

• The protein is a member of the interleukin 1 cytokine family.
• This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses.
• A polymorphism of its gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.