Interleukin 17 (IL-17) is a pro-inflammatory cytokine produced by a subset of T helper cells that develops distinct from the Th1- and Th2- cell differentiation pathways.
IL-17, also known as CTLA-8, stimulates induction of other pro-inflammatory cytokines TNF alpha, IL-1 beta, IL-6, and IL-8, and reports strongly suggest the involvement of IL-17 in several chronic inflammatory diseases such as rheumatoid arthritis, psoriasis and multiple sclerosis.
TGF-ß (differentiation) and IL-23 (expansion) are required for induction and maintenance of Th17 (IL-17 producing) cells, which in turn induce the other pro-inflammatory cytokines.
IL-17 (~32kD) protein is produced and exists as a homo-dimer, has homology to a herpes virus early protein, is one of the six members (IL-17A-F) of this cytokine family, and is well characterzed and highly expressed by activated effector memory T cells.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human IL17F.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Full length human IL17F, aa1-163 (NP_443104.1).
