83-6003-13　ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1) 50ug　128201

特徴

• The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors.
• The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts.
• This protein may play a role in cell growth, senescence, and differentiation.
• Two transcript variants encoding different isoforms have been found for this gene.
• [provided by RefSeq]
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilutions:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.