HSD17b14 (hydroxysteroid (17beta)dehydrogenase type 14), also called 17bHSD14 or DHRS10, is a cytoplasmic 17beta hydroxy steroid dehydrogenase that is a member of the SDR (shortchain dehydrogenase/reductase) family.
It is a 270aa, ~30kD protein with mRNA highly expressed in brain, placenta, liver and kidney.
It converts estradiol to estrone, thus inactivating it, and is thought to regulate activity of estrogens and possibly dihydroepiandrosterone (DHEA) in the placenta and central nervous system.
Human HSD17b14 shares 80.5% aa sequence identity with mouse and rat HSD17b14.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human HSD17B14.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human HSD17B14, aa1-270 (NP_057330.2).
