83-6002-51　HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) 50ug　127951

特徴

• It consists of a highly conserved AT-hook DNA-binding domain that mediates binding to AT-rich sequences in the minor groove of chromosomal DNA.
• It functions as architectural chromatin-binding transcription factor altering the conformation of DNA by modulating nuclear protein-DNA complexes.
• It is involved in many cellular processes including growth regulation, viral induction of beta-IFN gene and regulation of inducible gene transcription.
• It also physically interacts with transcription factors such as AP-1, Sp-1 and CAAT:enhancer binding protein-beta to modulate their ability to activate gene expression.
• It functions as a direct transcriptional target of c-Jun and c-Myc and is maximally expressed during embryonic development.
• Pathological role of HMGA1 include integration of retroviruses into chromosomes and enhancing metastasis of tumor cells.
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• AA Sequence:MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.