83-6001-22 GPRC5A (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, RAI3, GPCR5A, RAIG1) 50ug 127503
83-6001-22 GPRC5A (Retinoic Acid-induced Protein 3, G-protein Coupled Receptor Family C Group 5 Member A, Retinoic Acid-induced Gene 1 Protein, RAIG-1, Orphan G-protein-coupling Receptor PEIG-1, RAI3, GPCR5A, RAIG1) 50ug 127503
This G-protein coupled receptor could be involved in modulating differentiation and maintaining homeostasis of epithelial cells.
The comparable expression level in fetal lung and kidney with adult tissues suggests a possible role in embryonic development and maturation of these organs.
This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human GPRC5A.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human GPRC5A, aa1-357 (NP_003970.1).
