Four main species of sialic acid-rich glycoproteins known as glycophorins A, B, C, and D have been characterized on human erythrocytes.
These components carry blood group determinants and various receptors for lectins, bacteria, viruses, and parasites.
Glycophorin C (GPC) is the minor constituent carrying the Gerbich blood group antigens which plays significant role in the maintenance of erythrocyte shape by regulating the deformability and mechanical stability of red cells.
The protein is a single polypeptide chain of 128aa spanning the phospholipid bilayer.
The gene encoding for glycophorin C is mapped on 2q14-q21 region of human chromosome organized in four exons over 13.5kb pair DNA and contains two internal direct repeated domains of 3.4kb which are likely to derive from a recent duplication.
Glycophorin C has very little homology with glycophorin A and B.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human GYPC.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human GYPC, aa1-128 (NP_002092.1).
