The GAGE1 gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis.
The sequences of the family members are highly related but differ by scattered nucleotide substitutions.
The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.
Autologous cytolytic T lymphocytes recognise the antigenic peptide YRPRPRRY, which is also encoded by several other family members.
Nothing is presently known about the function of this protein.
An alternatively spliced transcript variant has been found for this gene.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human GAGE1.
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu
Immunogen：Full length human GAGE1, aa1-139 (NP_001459.2).
