83-5999-56　FST (Follistatin, FS, Activin-binding Protein) 50ug　126995

特徴

• Follistatin (FS) was initially identified as a follicle-stimulating hormone inhibiting substance found in ovarian follicular fluid.
• It has since been shown that FS is a high-affinity activin-binding protein that can act as an activin antagonist.
• Two alternatively spliced follistatin mRNAs, encoding mature FS with 288aa residues (FS-288) and 315aa residues (FS-315), exist.
• Natural FS purified from porcine ovaries is primarily a carboxy-terminal truncated form of FS-315 composed of 300aa residues.
• FS-288 binds with high-affinity to cell-surface heparan sulfate proteoglycans whereas FS-315 binds with low-affinity.
• Cell surface-associated FS has been suggested to play a role in the clearance and bioavailability of activin in vivo.
• Besides activin, FS has also been shown to bind with multiple BMPs and to inhibit BMP activity in early Xenopus embryos.
• FS deficient mice have been shown to have multiple embryonic defects that will result in death shortly after birth.
• Overexpression of FS can also cause reproductive defects in transgenic mice.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.