Fibromodulin (FMOD) is a Class II small leucine-rich proteoglycan (SLRP) superfamily member.
The ~50-70kD protein contains a sulfated N-terminal complement C1q binding domain (aa19-98) and 12 leucine-rich repeats (aa75-376).
A 40kD form is reported in dental tissues.
Fibromodulin participates in collagen fibrillogenesis in many tissues and competes with Lumican for collagen binding.
It can participate in inflammation by activating complement.
In epidermal keratinocytes, it may be located in the cytoplasm.
The region of human FMOD used as an immunogen shares 96% aa identity with mouse or rat FMOD.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MQWISLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVADVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human FMOD.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human FMOD, aa1-376 (AAH35281).