83-5998-08　FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) 50ug　126549

特徴

• The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family.
• FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type.
• They form 14-15kD proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids.
• They may also be responsible in the modulation of cell growth and proliferation.
• Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.