83-5997-76　ERC1 (ELKS, KIAA1081, RAB6IP2, ELKS/Rab6-interacting/CAST Family Member 1, Rab6-interacting Protein 2) 50ug　126423

特徴

• Regulatory subunit of the IKK complex.
• Probably recruits IkappaBalpha/NFKBIA to the complex.
• May be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release.
• May be involved in vesicle trafficking at the CAZ.
• May be involved in Rab-6 regulated endosomes to Golgi transport.
• The protein is a member of a family of RIM-binding proteins.
• RIMs are active zone proteins that regulate neurotransmitter release.
• This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13).
• Five transcript variants encoding different isoforms have been found for this gene.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.