CIDEA is a 24-27kD member of the CIDE family of molecules.
It is expressed in human adipocytes and striated muscle, plus mouse brown adipocytes and hepatocytes, and appears to have at least two functions.
In the cytoplasm of fat cells, CIDEA localizes to lipid droplets and ER, and promotes the formation of lipid droplets at the expense of lipolysis and AMPK activity.
In the nucleus, CIDEA apparently binds to LXR, and is capable of inducing apoptosis.
CIDEA undergoes O-linked glycosylation.
When glycosylated, CIDEA is nuclear; when nonglycosylated, CIDEA is cytoplasmic.
Human CIDEA is 219aa in length, and contains one CIDE domain aa33-110 that potentially mediates dimerization.
CIDEA reportedly homodimerizes, and heterodimerizes with CIDEB.
There is one potential isoform variant that possesses a 46aa substitution for aa1-12.
Over aa61-162, human CIDEA shares 89% aa identity with mouse CIDEA.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human CIDEA.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CIDEA, aa1-253 (NP_938031.1).