83-5993-83　CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) 50ug　124955

特徴

• This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes.
• The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase.
• The nomenclature has been updated recently to reflect the correct biological function of this encoded protein.
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• AA Sequence:MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.