CD62E is also known as ELAM-1, E-selectin and LECAM-2.
CD62E binds to CD15s and thereby mediates neutrophil adhesion to endothelium.
CD62E is expressed on activated endothelium and on chronically inflamed skin and synovial lesions.
This antibody blocks skin homing human lymphocytes from binding to E-selectin transfected cells.
This antibody also inhibits binding of human neutrophils and human myeloid cells (HL60 cell line) to IL-1 stimulated human umbilical vein endothelial cells and E-selectin transfected cells.
CD62E is a member of a small family of proteins known as the selectins.
Members of the selectin family are characterized by the presence of three homologous domains.
Located at the N-terminus is the homologous calcium ion-dependent lectin related domain which mediates ligand binding.
Adjacent to the lectin related domain is the homologous EGF-related domain.
Between the EGFrelated domain and the cell membrane is the complement regulatory domain composed of repeats which bear homology with complement regulatory proteins (CRP's).
Each of the selectins also possesses a transmembrane domain and a short cytoplasmic domain which corresponds to the C-terminus of the protein.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human SELE.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human SELE, aa1-610 (NP_000441.1).
