CD23, a 45kD Type II transmembrane glycoprotein, is a member of C-type Lectin family.
It is a human leukocyte differentiation antigen expressed in numerous hematopoietic lineage cells and consists of an extracellular lectin domain, alpha-helical coiled-coil stalk region, a transmembrane region and a cytoplasmic region.
It exists as 2 isoforms; CD23a is constitutively expressed in B-cells and expression of CD23b is induced by IL-4.
CD23 binds to CD21 antigen, CD11b, CD11c and also functions as a low-affinity receptor for human IgE (FcER2).
Role of CD23 include B-cell activation, differentiation, IgE synthesis, cell adhesion, regulating monocyte activation, antigen presentation and in the differentiation of early thymocytes.
Soluble fragment of CD23 promotes survival of germinal B-cell and increases histamine release from basophils.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human FCER2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human FCER2, aa1-321 (NP_001993.2).
