BAP31 appears to be a multi-functional ER-associated transport protein which was originally identified through its association with membrane IgD in B lymphocytes.
Several proteins have since been shown to associate with BAP31, including the Beta2 integrin receptor CD11b/CD18, and nonmuscle gamma-actin and myosin B heavy chain.
BAP31 has become a focus area for apoptosis studies due to its association with Bcl-2 and cleavage by initiator caspases including caspase 1 and 8.
Cleavage of BAP31 generates a membrane-integrated p20 fragment which is itself a potent inducer of apoptosis when expressed ectopically.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
抗体種類：Pab
宿主：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human BCAP31.
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu
Immunogen：Full-length human BCAP31, aa1-246 (NP_005736.3).
