Beta-arrestin 1 is a 418aa containing signaling neurotransmitter that belongs to the arrestin family with an arrestin N-terminal and an arrestin C-terminal domain.
A regulator of beta-adrenergic receptor function, Beta-arrestin 1 seems to bind to phosphorylated beta-adrenergic receptors, thereby causing a significant impairment of their capacity to activate G(S) proteins.
It is also reported to act as an activator of the lymphoid enhancer factor (LEF) transcription factor.
Beta-arrestin 1 plays a crucial role in ubiquitination and down-regulation of the insulin-like growth factor-1 receptor by acting as an adaptor for the MDM2 E3 ligase.
Purified beta-arrestin inhibits the signaling function of BARK-phosphorylated beta-adrenergic receptors by more than 75%, but not that of rhodopsin, and is also involved in synaptic transmission in photoreceptor cells.
It is widely expressed in most tissues.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human ARRB1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human ARRB1, aa1-418 (NP_004032.2).