83-5989-13　AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19, Golgi Adaptor HA1/AP1 Adaptin sigma-1A Subunit, HA1 19kD Subunit, Sigma 1a Subunit of AP-1 Clathrin, Sigma-adaptin 1A, Sigma1A-adaptin, AP19, CLAPS1) 50ug　123377

特徴

• Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes.
• The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.