Amphiregulin (AR) which binds to EGF-Receptor (EGFR) with lower affinity than EGF.
The mature secreted form AR is an 84aa residue glycosylated polypeptide growth regulator.
It is generated by proteolytic processing of a 252aa transmembrane precursor.
Seven different polypeptide ligands, which derive from distinct genes.
These ligands are capable of binding to the extracellular domain of EGFR.
They include EGF, TGFa, AR, HB-EGF, cripto-1, epiregulin and betacellulin.
All of these growth factors contain a characteristic EGF-like domain which is defined by 6 evenly spaced cysteine residues that generate 3 loops through the formation of disulfide bonds.
AR protein is localized to the epithelium of the colon, stomach, pancreas, breast and placenta.
AR is reportedly overexpressed in human cancers of breast, colon, stomach and pancreas.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human AREG.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human AREG, aa1-252 (NP_001648.1).