83-5988-46 AKR1E2 (AKR1CL2, 1,5-anhydro-D-fructose Reductase, AF Reductase, Aldo-keto Reductase Family 1 Member C-like Protein 2, Aldo-keto Reductase Family 1 Member E2, LoopADR, Testis-specific Protein, hTSP, AKRDC1, MGC10612) 50ug 123170
83-5988-46 AKR1E2 (AKR1CL2, 1,5-anhydro-D-fructose Reductase, AF Reductase, Aldo-keto Reductase Family 1 Member C-like Protein 2, Aldo-keto Reductase Family 1 Member E2, LoopADR, Testis-specific Protein, hTSP, AKRDC1, MGC10612) 50ug 123170
AKR1E2 catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol.
Can also catalyze the reduction of various aldehydes and quinones (By similarity).
Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro).
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
Storage and Stability:May be stored at 4℃ for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20℃.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
抗体種類:Pab
宿主:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human AKR1CL2. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human AKR1CL2, aa1-307 (AAH02862.1).