83-5986-46　Complement C1qB (Complement C1q Subcomponent Subunit B, Complement Component C1q B Chain, Complement Subcomponent C1q Chain B, C1QB) 50ug　C0010-10N2

特徴

• C1QB is a major constituent of the human complement subcomponent C1q.
• C1q associates with C1r and C1s in order to yield the first component of the serum complement system.
• Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis.
• C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains.
• Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region.
• The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
• Storage and Stability:May be stored at 4℃ for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20℃.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.