83-5961-31　TSPAN8 (Tetraspanin 8, CO-029,T M4SF3) 100ug　588797

特徴

• The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
• Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains.
• The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
• This encoded protein is a cell surface glycoprotein that is known to complex with integrins.
• This gene is expressed in different carcinomas.
• The use of alternate polyadenylation sites has been found for this gene.
• [provided by RefSeq]
• Applications:Suitable for use in Western Blot and Immunofluorescence.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
• Storage and Stability:May be stored at 4℃.
• For long-term storage, aliquot and store at 4℃.
• Do not freeze.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Further dilutions can be made in assay buffer.